DLX5 monoclonal antibody (M12), clone 3B11
  • DLX5 monoclonal antibody (M12), clone 3B11

DLX5 monoclonal antibody (M12), clone 3B11

Ref: AB-H00001749-M12
DLX5 monoclonal antibody (M12), clone 3B11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DLX5.
Información adicional
Size 100 ug
Gene Name DLX5
Gene Alias -
Gene Description distal-less homeobox 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1749
Clone Number 3B11
Iso type IgG1 Kappa

Enviar un mensaje


DLX5 monoclonal antibody (M12), clone 3B11

DLX5 monoclonal antibody (M12), clone 3B11