DLX5 monoclonal antibody (M07), clone 4H6
  • DLX5 monoclonal antibody (M07), clone 4H6

DLX5 monoclonal antibody (M07), clone 4H6

Ref: AB-H00001749-M07
DLX5 monoclonal antibody (M07), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLX5.
Información adicional
Size 100 ug
Gene Name DLX5
Gene Alias -
Gene Description distal-less homeobox 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX5 (NP_005212, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1749
Clone Number 4H6
Iso type IgG2a Kappa

Enviar un mensaje


DLX5 monoclonal antibody (M07), clone 4H6

DLX5 monoclonal antibody (M07), clone 4H6