DLX4 purified MaxPab rabbit polyclonal antibody (D01P)
  • DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001748-D01P
DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLX4 protein.
Información adicional
Size 100 ug
Gene Name DLX4
Gene Alias BP1|DLX7|DLX8|DLX9
Gene Description distal-less homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1748

Enviar un mensaje


DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

DLX4 purified MaxPab rabbit polyclonal antibody (D01P)