Ver mas grande
DLX4 MaxPab rabbit polyclonal antibody (D01)
AB-H00001748-D01
Producto nuevo
DLX4 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | DLX4 |
| Gene Alias | BP1|DLX7|DLX8|DLX9 |
| Gene Description | distal-less homeobox 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 1748 |
Más información
Rabbit polyclonal antibody raised against a full-length human DLX4 protein.