DLX4 MaxPab mouse polyclonal antibody (B01)
  • DLX4 MaxPab mouse polyclonal antibody (B01)

DLX4 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00001748-B01
DLX4 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human DLX4 protein.
Información adicional
Size 50 uL
Gene Name DLX4
Gene Alias BP1|DLX7|DLX8|DLX9
Gene Description distal-less homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1748

Enviar un mensaje


DLX4 MaxPab mouse polyclonal antibody (B01)

DLX4 MaxPab mouse polyclonal antibody (B01)