DLX3 purified MaxPab rabbit polyclonal antibody (D01P)
  • DLX3 purified MaxPab rabbit polyclonal antibody (D01P)

DLX3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001747-D01P
DLX3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLX3 protein.
Información adicional
Size 100 ug
Gene Name DLX3
Gene Alias AI4|TDO
Gene Description distal-less homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLX3 (NP_005211.1, 1 a.a. ~ 287 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1747

Enviar un mensaje


DLX3 purified MaxPab rabbit polyclonal antibody (D01P)

DLX3 purified MaxPab rabbit polyclonal antibody (D01P)