DLX3 polyclonal antibody (A01)
  • DLX3 polyclonal antibody (A01)

DLX3 polyclonal antibody (A01)

Ref: AB-H00001747-A01
DLX3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DLX3.
Información adicional
Size 50 uL
Gene Name DLX3
Gene Alias AI4|TDO
Gene Description distal-less homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX3 (AAH12361, 1 a.a. ~ 287 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1747

Enviar un mensaje


DLX3 polyclonal antibody (A01)

DLX3 polyclonal antibody (A01)