DLX1 monoclonal antibody (M01), clone 2H3
  • DLX1 monoclonal antibody (M01), clone 2H3

DLX1 monoclonal antibody (M01), clone 2H3

Ref: AB-H00001745-M01
DLX1 monoclonal antibody (M01), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLX1.
Información adicional
Size 100 ug
Gene Name DLX1
Gene Alias -
Gene Description distal-less homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq YLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX1 (NP_835221, 152 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1745
Clone Number 2H3
Iso type IgG2a Kappa

Enviar un mensaje


DLX1 monoclonal antibody (M01), clone 2H3

DLX1 monoclonal antibody (M01), clone 2H3