DLX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DLX1 purified MaxPab rabbit polyclonal antibody (D01P)

DLX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001745-D01P
DLX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLX1 protein.
Información adicional
Size 100 ug
Gene Name DLX1
Gene Alias -
Gene Description distal-less homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLX1 (NP_835221.2, 1 a.a. ~ 255 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1745

Enviar un mensaje


DLX1 purified MaxPab rabbit polyclonal antibody (D01P)

DLX1 purified MaxPab rabbit polyclonal antibody (D01P)