DLG4 purified MaxPab rabbit polyclonal antibody (D01P)
  • DLG4 purified MaxPab rabbit polyclonal antibody (D01P)

DLG4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001742-D01P
DLG4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLG4 protein.
Información adicional
Size 100 ug
Gene Name DLG4
Gene Alias FLJ97752|FLJ98574|PSD95|SAP-90|SAP90
Gene Description discs, large homolog 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLG4 (NP_001356.1, 1 a.a. ~ 767 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1742

Enviar un mensaje


DLG4 purified MaxPab rabbit polyclonal antibody (D01P)

DLG4 purified MaxPab rabbit polyclonal antibody (D01P)