DLG1 monoclonal antibody (M03), clone 1B12
  • DLG1 monoclonal antibody (M03), clone 1B12

DLG1 monoclonal antibody (M03), clone 1B12

Ref: AB-H00001739-M03
DLG1 monoclonal antibody (M03), clone 1B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLG1.
Información adicional
Size 100 ug
Gene Name DLG1
Gene Alias DKFZp761P0818|DKFZp781B0426|DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg
Gene Description discs, large homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1739
Clone Number 1B12
Iso type IgG1 Kappa

Enviar un mensaje


DLG1 monoclonal antibody (M03), clone 1B12

DLG1 monoclonal antibody (M03), clone 1B12