DLG1 monoclonal antibody (M01), clone 1D8
  • DLG1 monoclonal antibody (M01), clone 1D8

DLG1 monoclonal antibody (M01), clone 1D8

Ref: AB-H00001739-M01
DLG1 monoclonal antibody (M01), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLG1.
Información adicional
Size 50 ug
Gene Name DLG1
Gene Alias DKFZp761P0818|DKFZp781B0426|DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg
Gene Description discs, large homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,PLA-Ce
Immunogen Prot. Seq MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1739
Clone Number 1D8
Iso type IgG2a Kappa

Enviar un mensaje


DLG1 monoclonal antibody (M01), clone 1D8

DLG1 monoclonal antibody (M01), clone 1D8