DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)

DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001729-D01P
DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DIAPH1 protein.
Información adicional
Size 100 ug
Gene Name DIAPH1
Gene Alias DFNA1|DIA1|DRF1|FLJ25265|LFHL1|hDIA1
Gene Description diaphanous homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DIAPH1 (AAH07411, 1 a.a. ~ 404 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1729

Enviar un mensaje


DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)

DIAPH1 purified MaxPab rabbit polyclonal antibody (D01P)