DHODH polyclonal antibody (A01)
  • DHODH polyclonal antibody (A01)

DHODH polyclonal antibody (A01)

Ref: AB-H00001723-A01
DHODH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DHODH.
Información adicional
Size 50 uL
Gene Name DHODH
Gene Alias DHOdehase
Gene Description dihydroorotate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHODH (NP_001352, 32 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1723

Enviar un mensaje


DHODH polyclonal antibody (A01)

DHODH polyclonal antibody (A01)