COCH purified MaxPab mouse polyclonal antibody (B01P)
  • COCH purified MaxPab mouse polyclonal antibody (B01P)

COCH purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001690-B01P
COCH purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COCH protein.
Información adicional
Size 50 ug
Gene Name COCH
Gene Alias COCH-5B2|COCH5B2|DFNA9
Gene Description coagulation factor C homolog, cochlin (Limulus polyphemus)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVSTAHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGGNSNTGKALKHTAQKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COCH (AAH07230.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1690

Enviar un mensaje


COCH purified MaxPab mouse polyclonal antibody (B01P)

COCH purified MaxPab mouse polyclonal antibody (B01P)