DFNA5 monoclonal antibody (M01), clone 1E10
  • DFNA5 monoclonal antibody (M01), clone 1E10

DFNA5 monoclonal antibody (M01), clone 1E10

Ref: AB-H00001687-M01
DFNA5 monoclonal antibody (M01), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DFNA5.
Información adicional
Size 100 ug
Gene Name DFNA5
Gene Alias ICERE-1
Gene Description deafness, autosomal dominant 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DFNA5 (NP_004394.1, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1687
Clone Number 1E10
Iso type IgG2a Kappa

Enviar un mensaje


DFNA5 monoclonal antibody (M01), clone 1E10

DFNA5 monoclonal antibody (M01), clone 1E10