DFFB polyclonal antibody (A01)
  • DFFB polyclonal antibody (A01)

DFFB polyclonal antibody (A01)

Ref: AB-H00001677-A01
DFFB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DFFB.
Información adicional
Size 50 uL
Gene Name DFFB
Gene Alias CAD|CPAN|DFF-40|DFF2|DFF40
Gene Description DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DFFB (NP_004393, 229 a.a. ~ 338 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1677

Enviar un mensaje


DFFB polyclonal antibody (A01)

DFFB polyclonal antibody (A01)