DFFA monoclonal antibody (M05), clone 3A11
  • DFFA monoclonal antibody (M05), clone 3A11

DFFA monoclonal antibody (M05), clone 3A11

Ref: AB-H00001676-M05
DFFA monoclonal antibody (M05), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DFFA.
Información adicional
Size 100 ug
Gene Name DFFA
Gene Alias DFF-45|DFF1|ICAD
Gene Description DNA fragmentation factor, 45kDa, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1676
Clone Number 3A11
Iso type IgG2a Kappa

Enviar un mensaje


DFFA monoclonal antibody (M05), clone 3A11

DFFA monoclonal antibody (M05), clone 3A11