DEFA3 monoclonal antibody (M01), clone 1A9
  • DEFA3 monoclonal antibody (M01), clone 1A9

DEFA3 monoclonal antibody (M01), clone 1A9

Ref: AB-H00001668-M01
DEFA3 monoclonal antibody (M01), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DEFA3.
Información adicional
Size 100 ug
Gene Name DEFA3
Gene Alias DEF3|HNP-3|HNP3|HP-3
Gene Description defensin, alpha 3, neutrophil-specific
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DEFA3 (NP_005208.1, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1668
Clone Number 1A9
Iso type IgG2a Kappa

Enviar un mensaje


DEFA3 monoclonal antibody (M01), clone 1A9

DEFA3 monoclonal antibody (M01), clone 1A9