DHX8 monoclonal antibody (M07), clone 1D6
  • DHX8 monoclonal antibody (M07), clone 1D6

DHX8 monoclonal antibody (M07), clone 1D6

Ref: AB-H00001659-M07
DHX8 monoclonal antibody (M07), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHX8.
Información adicional
Size 100 ug
Gene Name DHX8
Gene Alias DDX8|HRH1|PRP22|PRPF22
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHX8 (NP_004932, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1659
Clone Number 1D6
Iso type IgG1 Kappa

Enviar un mensaje


DHX8 monoclonal antibody (M07), clone 1D6

DHX8 monoclonal antibody (M07), clone 1D6