DDT purified MaxPab mouse polyclonal antibody (B01P)
  • DDT purified MaxPab mouse polyclonal antibody (B01P)

DDT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001652-B01P
DDT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DDT protein.
Información adicional
Size 50 ug
Gene Name DDT
Gene Alias DDCT
Gene Description D-dopachrome tautomerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDT (NP_001346.1, 1 a.a. ~ 118 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1652

Enviar un mensaje


DDT purified MaxPab mouse polyclonal antibody (B01P)

DDT purified MaxPab mouse polyclonal antibody (B01P)