DDIT3 monoclonal antibody (M03), clone 2C4
  • DDIT3 monoclonal antibody (M03), clone 2C4

DDIT3 monoclonal antibody (M03), clone 2C4

Ref: AB-H00001649-M03
DDIT3 monoclonal antibody (M03), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDIT3.
Información adicional
Size 100 ug
Gene Name DDIT3
Gene Alias CEBPZ|CHOP|CHOP10|GADD153|MGC4154
Gene Description DNA-damage-inducible transcript 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDIT3 (AAH03637.1, 94 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1649
Clone Number 2C4
Iso type IgG2a Kappa

Enviar un mensaje


DDIT3 monoclonal antibody (M03), clone 2C4

DDIT3 monoclonal antibody (M03), clone 2C4