GADD45A monoclonal antibody (M01), clone 3D12
  • GADD45A monoclonal antibody (M01), clone 3D12

GADD45A monoclonal antibody (M01), clone 3D12

Ref: AB-H00001647-M01
GADD45A monoclonal antibody (M01), clone 3D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GADD45A.
Información adicional
Size 100 ug
Gene Name GADD45A
Gene Alias DDIT1|GADD45
Gene Description growth arrest and DNA-damage-inducible, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,PLA-Ce
Immunogen Prot. Seq TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GADD45A (AAH11757, 76 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1647
Clone Number 3D12
Iso type IgG1 kappa

Enviar un mensaje


GADD45A monoclonal antibody (M01), clone 3D12

GADD45A monoclonal antibody (M01), clone 3D12