GADD45A purified MaxPab mouse polyclonal antibody (B01P)
  • GADD45A purified MaxPab mouse polyclonal antibody (B01P)

GADD45A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001647-B01P
GADD45A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GADD45A protein.
Información adicional
Size 50 ug
Gene Name GADD45A
Gene Alias DDIT1|GADD45
Gene Description growth arrest and DNA-damage-inducible, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GADD45A (AAH11757.1, 1 a.a. ~ 165 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1647

Enviar un mensaje


GADD45A purified MaxPab mouse polyclonal antibody (B01P)

GADD45A purified MaxPab mouse polyclonal antibody (B01P)