DDB2 monoclonal antibody (M01), clone 1F11
  • DDB2 monoclonal antibody (M01), clone 1F11

DDB2 monoclonal antibody (M01), clone 1F11

Ref: AB-H00001643-M01
DDB2 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDB2.
Información adicional
Size 100 ug
Gene Name DDB2
Gene Alias DDBB|FLJ34321|UV-DDB2
Gene Description damage-specific DNA binding protein 2, 48kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDB2 (AAH00093, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1643
Clone Number 1F11
Iso type IgG2b Kappa

Enviar un mensaje


DDB2 monoclonal antibody (M01), clone 1F11

DDB2 monoclonal antibody (M01), clone 1F11