DDB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DDB2 purified MaxPab rabbit polyclonal antibody (D01P)

DDB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001643-D01P
DDB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDB2 protein.
Información adicional
Size 100 ug
Gene Name DDB2
Gene Alias DDBB|FLJ34321|UV-DDB2
Gene Description damage-specific DNA binding protein 2, 48kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDB2 (NP_000098.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1643

Enviar un mensaje


DDB2 purified MaxPab rabbit polyclonal antibody (D01P)

DDB2 purified MaxPab rabbit polyclonal antibody (D01P)