DCT purified MaxPab rabbit polyclonal antibody (D01P)
  • DCT purified MaxPab rabbit polyclonal antibody (D01P)

DCT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001638-D01P
DCT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DCT protein.
Información adicional
Size 100 ug
Gene Name DCT
Gene Alias TYRP2
Gene Description dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DCT (NP_001913.2, 1 a.a. ~ 519 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1638

Enviar un mensaje


DCT purified MaxPab rabbit polyclonal antibody (D01P)

DCT purified MaxPab rabbit polyclonal antibody (D01P)