DCTD monoclonal antibody (M01), clone 4B9
  • DCTD monoclonal antibody (M01), clone 4B9

DCTD monoclonal antibody (M01), clone 4B9

Ref: AB-H00001635-M01
DCTD monoclonal antibody (M01), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DCTD.
Información adicional
Size 100 ug
Gene Name DCTD
Gene Alias MGC111062
Gene Description dCMP deaminase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq RTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCTD (NP_001912.2, 69 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1635
Clone Number 4B9
Iso type IgG3 Kappa

Enviar un mensaje


DCTD monoclonal antibody (M01), clone 4B9

DCTD monoclonal antibody (M01), clone 4B9