DCK monoclonal antibody (M01), clone 1E7
  • DCK monoclonal antibody (M01), clone 1E7

DCK monoclonal antibody (M01), clone 1E7

Ref: AB-H00001633-M01
DCK monoclonal antibody (M01), clone 1E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DCK.
Información adicional
Size 100 ug
Gene Name DCK
Gene Alias MGC117410|MGC138632
Gene Description deoxycytidine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCK (NP_000779, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1633
Clone Number 1E7
Iso type IgG2a Kappa

Enviar un mensaje


DCK monoclonal antibody (M01), clone 1E7

DCK monoclonal antibody (M01), clone 1E7