DBP monoclonal antibody (M01), clone 3A6
  • DBP monoclonal antibody (M01), clone 3A6

DBP monoclonal antibody (M01), clone 3A6

Ref: AB-H00001628-M01
DBP monoclonal antibody (M01), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DBP.
Información adicional
Size 100 ug
Gene Name DBP
Gene Alias DABP
Gene Description D site of albumin promoter (albumin D-box) binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DBP (NP_001343, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1628
Clone Number 3A6
Iso type IgG1 Kappa

Enviar un mensaje


DBP monoclonal antibody (M01), clone 3A6

DBP monoclonal antibody (M01), clone 3A6