DBP polyclonal antibody (A01)
  • DBP polyclonal antibody (A01)

DBP polyclonal antibody (A01)

Ref: AB-H00001628-A01
DBP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DBP.
Información adicional
Size 50 uL
Gene Name DBP
Gene Alias DABP
Gene Description D site of albumin promoter (albumin D-box) binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DBP (NP_001343, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1628

Enviar un mensaje


DBP polyclonal antibody (A01)

DBP polyclonal antibody (A01)