DBC1 MaxPab rabbit polyclonal antibody (D01)
  • DBC1 MaxPab rabbit polyclonal antibody (D01)

DBC1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001620-D01
DBC1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DBC1 protein.
Información adicional
Size 100 uL
Gene Name DBC1
Gene Alias DBCCR1|FAM5A
Gene Description deleted in bladder cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DBC1 (AAH21560.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1620

Enviar un mensaje


DBC1 MaxPab rabbit polyclonal antibody (D01)

DBC1 MaxPab rabbit polyclonal antibody (D01)