DAZ1 monoclonal antibody (M09), clone 3A4
  • DAZ1 monoclonal antibody (M09), clone 3A4

DAZ1 monoclonal antibody (M09), clone 3A4

Ref: AB-H00001617-M09
DAZ1 monoclonal antibody (M09), clone 3A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DAZ1.
Información adicional
Size 100 ug
Gene Name DAZ1
Gene Alias DAZ|SPGY
Gene Description deleted in azoospermia 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAZ1 (AAH18119, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1617
Clone Number 3A4
Iso type IgG1 Kappa

Enviar un mensaje


DAZ1 monoclonal antibody (M09), clone 3A4

DAZ1 monoclonal antibody (M09), clone 3A4