DAZ1 polyclonal antibody (A01)
  • DAZ1 polyclonal antibody (A01)

DAZ1 polyclonal antibody (A01)

Ref: AB-H00001617-A01
DAZ1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DAZ1.
Información adicional
Size 50 uL
Gene Name DAZ1
Gene Alias DAZ|SPGY
Gene Description deleted in azoospermia 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAZ1 (AAH18119, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1617

Enviar un mensaje


DAZ1 polyclonal antibody (A01)

DAZ1 polyclonal antibody (A01)