DARS polyclonal antibody (A02)
  • DARS polyclonal antibody (A02)

DARS polyclonal antibody (A02)

Ref: AB-H00001615-A02
DARS polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DARS.
Información adicional
Size 50 uL
Gene Name DARS
Gene Alias DKFZp781B11202|MGC111579
Gene Description aspartyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DARS (AAH00629, 1 a.a. ~ 501 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1615

Enviar un mensaje


DARS polyclonal antibody (A02)

DARS polyclonal antibody (A02)