DAPK1 monoclonal antibody (M01), clone 2E7
  • DAPK1 monoclonal antibody (M01), clone 2E7

DAPK1 monoclonal antibody (M01), clone 2E7

Ref: AB-H00001612-M01
DAPK1 monoclonal antibody (M01), clone 2E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DAPK1.
Información adicional
Size 100 ug
Gene Name DAPK1
Gene Alias DAPK|DKFZp781I035
Gene Description death-associated protein kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAPK1 (NP_004929, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1612
Clone Number 2E7
Iso type IgG1 kappa

Enviar un mensaje


DAPK1 monoclonal antibody (M01), clone 2E7

DAPK1 monoclonal antibody (M01), clone 2E7