DAP monoclonal antibody (M01), clone 3C5
  • DAP monoclonal antibody (M01), clone 3C5

DAP monoclonal antibody (M01), clone 3C5

Ref: AB-H00001611-M01
DAP monoclonal antibody (M01), clone 3C5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DAP.
Información adicional
Size 100 ug
Gene Name DAP
Gene Alias MGC99796
Gene Description death-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAP (AAH02726, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1611
Clone Number 3C5
Iso type IgG2a Kappa

Enviar un mensaje


DAP monoclonal antibody (M01), clone 3C5

DAP monoclonal antibody (M01), clone 3C5