DGKG MaxPab rabbit polyclonal antibody (D01)
  • DGKG MaxPab rabbit polyclonal antibody (D01)

DGKG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001608-D01
DGKG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DGKG protein.
Información adicional
Size 100 uL
Gene Name DGKG
Gene Alias DAGK3|DGK-GAMMA|MGC104993|MGC133330
Gene Description diacylglycerol kinase, gamma 90kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DGKG (NP_001074213.1, 1 a.a. ~ 766 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1608

Enviar un mensaje


DGKG MaxPab rabbit polyclonal antibody (D01)

DGKG MaxPab rabbit polyclonal antibody (D01)