DAD1 monoclonal antibody (M03), clone 2B4-C8
  • DAD1 monoclonal antibody (M03), clone 2B4-C8

DAD1 monoclonal antibody (M03), clone 2B4-C8

Ref: AB-H00001603-M03
DAD1 monoclonal antibody (M03), clone 2B4-C8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DAD1.
Información adicional
Size 50 ug
Gene Name DAD1
Gene Alias OST2
Gene Description defender against cell death 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAD1 (AAH07403, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1603
Clone Number 2B4-C8
Iso type IgG2b Kappa

Enviar un mensaje


DAD1 monoclonal antibody (M03), clone 2B4-C8

DAD1 monoclonal antibody (M03), clone 2B4-C8