CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001588-D01P
CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP19A1 protein.
Información adicional
Size 100 ug
Gene Name CYP19A1
Gene Alias ARO|ARO1|CPV1|CYAR|CYP19|MGC104309|P-450AROM
Gene Description cytochrome P450, family 19, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRISLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP19A1 (AAH35959.1, 1 a.a. ~ 503 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1588

Enviar un mensaje


CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)

CYP19A1 purified MaxPab rabbit polyclonal antibody (D01P)