CYP7A1 monoclonal antibody (M01), clone 8F1
  • CYP7A1 monoclonal antibody (M01), clone 8F1

CYP7A1 monoclonal antibody (M01), clone 8F1

Ref: AB-H00001581-M01
CYP7A1 monoclonal antibody (M01), clone 8F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP7A1.
Información adicional
Size 100 ug
Gene Name CYP7A1
Gene Alias CP7A|CYP7|MGC126826|MGC138389
Gene Description cytochrome P450, family 7, subfamily A, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP7A1 (NP_000771.2, 179 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1581
Clone Number 8F1
Iso type IgG2a Kappa

Enviar un mensaje


CYP7A1 monoclonal antibody (M01), clone 8F1

CYP7A1 monoclonal antibody (M01), clone 8F1