CYP2E1 polyclonal antibody (A01)
  • CYP2E1 polyclonal antibody (A01)

CYP2E1 polyclonal antibody (A01)

Ref: AB-H00001571-A01
CYP2E1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYP2E1.
Información adicional
Size 50 uL
Gene Name CYP2E1
Gene Alias CPE1|CYP2E|P450-J|P450C2E
Gene Description cytochrome P450, family 2, subfamily E, polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP2E1 (NP_000764, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1571

Enviar un mensaje


CYP2E1 polyclonal antibody (A01)

CYP2E1 polyclonal antibody (A01)