CYP2A13 MaxPab rabbit polyclonal antibody (D01)
  • CYP2A13 MaxPab rabbit polyclonal antibody (D01)

CYP2A13 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001553-D01
CYP2A13 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP2A13 protein.
Información adicional
Size 100 uL
Gene Name CYP2A13
Gene Alias CPAD|CYP2A
Gene Description cytochrome P450, family 2, subfamily A, polypeptide 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP2A13 (AAI53001.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1553

Enviar un mensaje


CYP2A13 MaxPab rabbit polyclonal antibody (D01)

CYP2A13 MaxPab rabbit polyclonal antibody (D01)