CYP1A2 monoclonal antibody (M09), clone 4B3
  • CYP1A2 monoclonal antibody (M09), clone 4B3

CYP1A2 monoclonal antibody (M09), clone 4B3

Ref: AB-H00001544-M09
CYP1A2 monoclonal antibody (M09), clone 4B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP1A2.
Información adicional
Size 100 ug
Gene Name CYP1A2
Gene Alias CP12|P3-450|P450(PA)
Gene Description cytochrome P450, family 1, subfamily A, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1544
Clone Number 4B3
Iso type IgG3 Kappa

Enviar un mensaje


CYP1A2 monoclonal antibody (M09), clone 4B3

CYP1A2 monoclonal antibody (M09), clone 4B3