Ver mas grande
CYLD monoclonal antibody (M08), clone 2F9
AB-H00001540-M08
Producto nuevo
CYLD monoclonal antibody (M08), clone 2F9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CYLD |
| Gene Alias | CDMT|CYLD1|CYLDI|EAC|FLJ20180|FLJ31664|FLJ78684|HSPC057|KIAA0849|MFT|MFT1|SBS|TEM|USPL2 |
| Gene Description | cylindromatosis (turban tumor syndrome) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1540 |
| Clone Number | 2F9 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CYLD.