CYLD monoclonal antibody (M01), clone 2C3 Ver mas grande

CYLD monoclonal antibody (M01), clone 2C3

AB-H00001540-M01

Producto nuevo

CYLD monoclonal antibody (M01), clone 2C3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name CYLD
Gene Alias CDMT|CYLD1|CYLDI|EAC|FLJ20180|FLJ31664|FLJ78684|HSPC057|KIAA0849|MFT|MFT1|SBS|TEM|USPL2
Gene Description cylindromatosis (turban tumor syndrome)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1540
Clone Number 2C3
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant CYLD.

Consulta sobre un producto

CYLD monoclonal antibody (M01), clone 2C3

CYLD monoclonal antibody (M01), clone 2C3