CYLC2 purified MaxPab mouse polyclonal antibody (B01P)
  • CYLC2 purified MaxPab mouse polyclonal antibody (B01P)

CYLC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001539-B01P
CYLC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYLC2 protein.
Información adicional
Size 50 ug
Gene Name CYLC2
Gene Alias MGC129591
Gene Description cylicin, basic protein of sperm head cytoskeleton 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYLC2 (NP_001331.1, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1539

Enviar un mensaje


CYLC2 purified MaxPab mouse polyclonal antibody (B01P)

CYLC2 purified MaxPab mouse polyclonal antibody (B01P)