CYLC1 monoclonal antibody (M04), clone 6F12
  • CYLC1 monoclonal antibody (M04), clone 6F12

CYLC1 monoclonal antibody (M04), clone 6F12

Ref: AB-H00001538-M04
CYLC1 monoclonal antibody (M04), clone 6F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYLC1.
Información adicional
Size 100 ug
Gene Name CYLC1
Gene Alias CYCL1
Gene Description cylicin, basic protein of sperm head cytoskeleton 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SSKTGFKTSTKIKGSDTESEESLYKPGAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYLC1 (XP_088636.6, 526 a.a. ~ 625 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1538
Clone Number 6F12
Iso type IgG2a Kappa

Enviar un mensaje


CYLC1 monoclonal antibody (M04), clone 6F12

CYLC1 monoclonal antibody (M04), clone 6F12