CYC1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYC1 purified MaxPab rabbit polyclonal antibody (D01P)

CYC1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001537-D01P
CYC1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYC1 protein.
Información adicional
Size 100 ug
Gene Name CYC1
Gene Alias UQCR4
Gene Description cytochrome c-1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYC1 (NP_001907.2, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1537

Enviar un mensaje


CYC1 purified MaxPab rabbit polyclonal antibody (D01P)

CYC1 purified MaxPab rabbit polyclonal antibody (D01P)