CXADR purified MaxPab mouse polyclonal antibody (B01P)
  • CXADR purified MaxPab mouse polyclonal antibody (B01P)

CXADR purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001525-B01P
CXADR purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CXADR protein.
Información adicional
Size 50 ug
Gene Name CXADR
Gene Alias CAR|HCAR
Gene Description coxsackie virus and adenovirus receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXADR (NP_001329.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1525

Enviar un mensaje


CXADR purified MaxPab mouse polyclonal antibody (B01P)

CXADR purified MaxPab mouse polyclonal antibody (B01P)